PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G02186.1.p
Common NameEUGRSUZ_G02186, LOC104453714
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 229aa    MW: 25157.4 Da    PI: 9.0027
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G02186.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.91e-1969123256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ ++tkeq + Lee F++n++++ +++e LA++l+L  rqV vWFqNrRa+ k
  Eucgr.G02186.1.p  69 RKKLRLTKEQSRLLEESFRQNHTLNPKQKEALAAQLKLRPRQVEVWFQNRRARSK 123
                       78889************************************************98 PP

2HD-ZIP_I/II118.92.8e-3869157190
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                       +kk+rl+keq++lLEesF+++++L+p++K++la +L+l+prqv+vWFqnrRAR k+kq+E+++e+Lkr++ +l+e+n+rL++eveeLr +
  Eucgr.G02186.1.p  69 RKKLRLTKEQSRLLEESFRQNHTLNPKQKEALAAQLKLRPRQVEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEQNRRLQREVEELR-A 157
                       69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-2047123IPR009057Homeodomain-like
SuperFamilySSF466893.55E-2051126IPR009057Homeodomain-like
PROSITE profilePS5007117.39465125IPR001356Homeobox domain
SMARTSM003893.0E-1867129IPR001356Homeobox domain
CDDcd000861.11E-1768126No hitNo description
PfamPF000464.5E-1769123IPR001356Homeobox domain
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
PfamPF021831.2E-9125159IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.4E-22125168IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MGDLGDFPGS SSSLELTISV PGFSSSPPLP SSVRDLDINQ VPSGGEEEWM TMSGGMEDEE  60
ESSHGGPPRK KLRLTKEQSR LLEESFRQNH TLNPKQKEAL AAQLKLRPRQ VEVWFQNRRA  120
RSKLKQTEME CEYLKRWFGS LTEQNRRLQR EVEELRALKV GPPTVISPHT CQPLPASTLS  180
MCPRCERVTS TAPPPTSTSA PSAATRAPSK ASQLSPPSVH SRQPSAAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117125RRARSKLKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G02186.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010066623.11e-165PREDICTED: homeobox-leucine zipper protein HOX3
SwissprotQ0JKX13e-91HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH383e-91HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLA0A059BFY61e-165A0A059BFY6_EUCGR; Uncharacterized protein
STRINGVIT_01s0011g04870.t011e-115(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48902747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.13e-67homeobox-leucine zipper protein 17